
Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Calcitonin » Anti -Calcitonin (Alpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1, CGRP, CT, Katacalcin, KC, MGC126648)

Anti -Calcitonin (Alpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1,
CGRP, CT, Katacalcin, KC, MGC126648)


  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.


Clone Host Grade Applications
Polyclonal Sheep Serum RIA
Catalog #C0115-08F
ApplicationsSuitable for use in RIA. Other applications not tested.
Recommended DilutionsRIA: 1:80,000
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
ConcentrationNot Determined
FormSupplied as a lyophilized powder. Reconstitute with 20ul sterile ddH2O.
ImmunogenSynthetic peptide corresponding to CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP from human Calcitonin, comjugated to BSA
SpecificityRecognizes human Calcitonin
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Alternate namesAlpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1, CGRP, CT, Katacalcin, KC, MGC126648

External Links