Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Calcitonin » Anti -Calcitonin (Alpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1, CGRP, CT, Katacalcin, KC, MGC126648)

Anti -Calcitonin (Alpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1,
CGRP, CT, Katacalcin, KC, MGC126648)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Rabbit Serum RIA
Catalog #C0115-08G
ApplicationsSuitable for use in RIA. Other applications not tested.
Recommended DilutionRIA: 1:15,000
Optimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
CAS Numbern/a
Clone TypePolyclonal
HostRabbit
SourceHuman
Concentration~1mg/ml
FormSupplied as a lyophilized powder in PBS, pH 7.2. Reconstitute in ddH2O.
PuritySerum
ImmunogenSynthetic human Calcitonin, BSA-conjugated
(CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP)
SpecificityRecognizes Human Calcitonin. There were no cross reactivities obtained with human Katacalcin
and human Calcitonin Gene related Peptide.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Alternate namesAlpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1, CGRP, CT, Katacalcin, KC, MGC126648


External Links