Anti -Calcitonin (Alpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1, CGRP, CT, Katacalcin, KC, MGC126648)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Rabbit |
Serum |
RIA |
|
| Catalog # | C0115-08G | | Applications | Suitable for use in RIA. Other applications not tested. | | Recommended Dilution | RIA: 1:15,000 | | Optimal dilutions to be determined by the researcher. | | Storage and Stability | Lyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | CAS Number | n/a | | Clone Type | Polyclonal | | Host | Rabbit | | Source | Human | | Concentration | ~1mg/ml | | Form | Supplied as a lyophilized powder in PBS, pH 7.2. Reconstitute in ddH2O. | | Purity | Serum | | Immunogen | Synthetic human Calcitonin, BSA-conjugated | | (CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP) | | Specificity | Recognizes Human Calcitonin. There were no cross reactivities obtained with human Katacalcin | | and human Calcitonin Gene related Peptide. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. | | Alternate names | Alpha CGRP, CALC1, CALCA, Calcitonin related polypeptide alpha, CGRP1, CGRP, CT, Katacalcin, KC, MGC126648 |
External Links
|