You are here:Home
»
Molecular Biology
»
MB-CD Markers
»
CD105, Recombinant, Mouse (Endoglin, ENG, END)
CD105, Recombinant, Mouse (Endoglin, ENG, END)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Endoglin is a type I membrane glycoprotein located on cell surfaces and is part of the TGF beta receptor complex.The protein consists of a homodimer of 180kD with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts, and smooth muscle cells. Endoglin has been found to be part of the TGF-beta1 receptor complex and may be involved in the binding of TGF-beta1, TGF-beta3, activin-A, BMP-2, and BMP-7. It has been postulated that endoglin is involved in the cytoskeletal organization affecting cell morphology and migration. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling. Its expression is regulated during heart development . CD105 Mouse Recombinant extracellular domain produced in baculovirus is a homodimeric, glycosylated, polypeptide containing 581aa and having a molecular mass of 61kD but as a result of glycosylation, migrates at 75-85kD under reducing conditions in SDS-PAGE. Based on N-terminal sequence analysis, the primary structure of recombinant mature Endoglin starts at Glu 26. The CD105 is fused to a C-terminal His-tag (6xHis) and purified by proprietary chromatographic techniques. | | | Catalog # | C2446-55M | | Source | Recombinant corresponding to mouse Endoglin expressed in Sf9 cells. | | AA Sequence | MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHV-LFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRV-NITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPR-AQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSM-QILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTT-PAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDH-LVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELG-QQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRV-YMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS | | Molecular Weight | ~75-85kD | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | ~75-85kD | | Source | Sf9 cells | | Purity | ~95% (SDS-PAGE, HPLC) | | Concentration | Not determined | | Form | Supplied as a lyophilized powder from a sterile solution. Reconstitute with sterile PBS to 100ug/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
