You are here:Home
»
Antibodies
»
Abs to Cancer Markers
»
Anti -CEACAM 21 (CEACAM21, Carcinoembryonic Antigen-related Cell Adhesion Molecule 21, UNQ3098/PRO10075)
Anti -CEACAM 21 (CEACAM21, Carcinoembryonic Antigen-related Cell Adhesion Molecule 21,
UNQ3098/PRO10075)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Rabbit |
Purified |
B |
|
| Catalog # | C2589-87P | | Applications | Suitable for use in Western Blot. Other applications not tested. | | Recommended Dilutions | Western Blot (Tissue lysate): 1:500-1:1000 using human liver lysates | | Western Blot (Transfected lysate): 1:1000-1:2000 detects a band at ~21.5kD using CEACAM21 transfected 293T lysate. | | Optimal dilutions to be determined by the researcher. | | Amino Acid Sequence | MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | | CAS Number | n/a | | Clone Type | Polyclonal | | Isotype | IgG | | Host | Rabbit | | Source | Human | | Concentration | ~1mg/ml | | Form | Supplied as a liquid in PBS, pH 7.2. | | Purity | Purified | | Immunogen | Full length protein corresponding to aa1-191 of human CEACAM21 (AAH12001.1) | | Specificity | Recognizes human CEACAM21. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
