You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-CNTF
»
Ciliary Neurotropic Factor, Recombinant, Rat (CNTF)
Ciliary Neurotropic Factor, Recombinant, Rat (CNTF)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. CNTF is a survival factor for various neuronal cell types and seems to prevent the degeneration of motor axons after axotomy. CNTF Recombinant Rat produced in E. coli is a single, non-glycosylated polypeptide chain containing 200aa and having a molecular mass of 22834D. The CNTF is purified by proprietary chromatographic techniques. | | | Catalog # | C5073-01A | | Source | Recombinant corresponding to rat CNTF expressed in E. coli. | | AA Sequence | AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEM- TEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDG-GLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM | | Molecular Weight | ~22.834kD | | Biological Activity | Fully biologically active by its ability to phosphorylate STAT3 in several cells lines. | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | ~22.834kD | | Source | E. coli | | Purity | ~99% (SDS-PAGE) | | Concentration | Not determined | | Form | Supplied as a lyophilized powder from 0.025% sodium bicarbonate. Reconstitute in sterile dH2O or 0.4 % sodium bicarbonate adjusted to pH 8-9 to 100ug/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
