CXCL11, Recombinant, Human (Chemokine (C-X-C Motif) Ligand 11, b R1, H174,
Interferon-inducible T Cell Alpha Chemoattractant, I-TAC, Interferon gamma Inducible
Protein 9, IP-9, MGC102770, Small Inducible Cytokine B11, SCYB11, SCYB9B)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| CXCL11 cDNA encodes a 94 amino acid (aa) residue precursor protein with a 21 aa residue putative signal sequence, which is cleaved to form the mature 73 aa residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. CXCL11 is expressed at low levels in normal tissues including thymus, spleen and pancreas. The expression of CXCL11 mRNA is radically up regulated in IFN-y and IL-1 stimulated astrocytes. Moderate increase in expression is also observed in stimulated monocytes. CXCL11 has potent chemoattractant activity for IL-2 activated T cells and transfected cell lines expressing CXCR3, but not freshly isolated T-cells, neutrophils or monocytes. | | | Catalog # | C8297-99D | | Biological Activity | Fully biologically active when compared to standard. Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng/ml. | | AA Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPK | | SKQARLIIKKVERKNF | | Endotoxin | 1EU/ug as determined by LAL method. | | Storage and Stability | Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months. | | Molecular Weight | 8.3 kD | | Source | Escherichia coli | | Purity | ~97% by SDS-PAGE and HPLC analyses. | | Concentration | 1mg/ml | | Form | Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
|
|
Questions or comments about this product? Inquire here. |
|
|
Download Specifications for CXCL11, Recombinant, Human (Chemokine (C-X-C Motif) Ligand 11, b R1, H174, Interferon-inducible T Cell Alpha Chemoattractant, I-TAC, Interferon gamma Inducible Protein 9, IP-9, MGC102770, Small Inducible Cytokine B11, SCYB11, SCYB9B) |
External Links
|
