Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Molecular Biology » MB-BioSep Assay Detection/Tags » Cyan Fluorescent Protein, Recombinant (CFP)

Cyan Fluorescent Protein, Recombinant (CFP)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Catalog #C8385-01A
The recombinant CFP (Cyan Fluorescent Protein) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal CFP fluorescence. Endotoxin has been removed, and the protein is suitable for cell culture applications. The protein is a 29kD monomer with 264aa, and an N-terminal His tag, Ex./Em.=458/480nm, Extinction coefficient 26000M-1CM-1.
ApplicationsSuitable for use as a control reagent for CFP expression studies or as a labeling reagent. Also suitable for use as standards for SDS-PAGE, Western blot of CFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope or microinjection of CFP into cells and tissues, etc. The recombinant CFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP, RFP Cat #R1310-01B, or YFP, Cat #Y2043-01. Other applications not tested.
Recommended DilutionsOptimal dilutions to be determined by the researcher.
AMINO ACID SEQUENCEMSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPV PWPTLVTTLAWGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRG EVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISDNVYIMPDKANNGLEANF KIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVL LESFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR
Storage and Stability:
May be stored at 4°C for short-term only. For long-term storage, aliquot to avoid repeated freezing and thawing and freeze at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
SourceE. coli
Purity97% (SDS-PAGE and HPLC)
Concentration~1mg/ml (after reconstitution)
FormSupplied as a lyophilized powder. Reconstitute with 100ul of ddH2O.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links