You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-ENA78
»
ENA78, Recombinant, Human (Epithelial Neutrophil Activating Peptide 78)(5-78aa)
ENA78, Recombinant, Human (Epithelial Neutrophil Activating Peptide 78)(5-78aa)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-70 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-70 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays. | | | Catalog # | E2275-07B | | Biological Activity | Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 5.0-50.0ng/ml. | | AA Sequence | AVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAP | | FLKKVIQKILDGGNKEN | | Endotoxin | 1EU/ug as determined by LAL method. | | Storage and Stability | Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months. | | Molecular Weight | 8.0 kD | | Source | Escherichia coli | | Purity | ~97% by SDS-PAGE and HPLC analyses. | | Concentration | 1mg/ml | | Form | Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
