You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-FGF
»
Fibroblast Growth Factor 21, Recombinant, Mouse (FGF-21, Fgf21)
Fibroblast Growth Factor 21, Recombinant, Mouse (FGF-21, Fgf21)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| The FGFs are a family of more than 20 small (~17–26kD) secreted peptides. The initial characterization of these proteins focused on their ability to stimulate fibroblast proliferation. FGFs modulate cellular activity via at least 5 distinct subfamilies of high-affinity FGF receptors (FGFRs): FGFR-1, -2, -3, and -4, all with intrinsic tyrosine kinase activity and, except for FGFR-4, multiple splice isoforms, and FGFR-5, which lacks an intracellular kinase domain. There is growing evidence that FGFRs can be important for regulation of glucose and lipid homeostasis. FGFR-2 appears to be a key molecule during pancreatic development and FGFR-4 has been implicated in cholesterol metabolism and bile acid synthesis. FGF-21 is preferentially expressed in liver, but an exact knowledge of FGF-21 bioactivity and its mode of action have been lacking to date. FGF-21 is a potent activator of glucose uptake on adipocytes, protects animals from diet-induced obesity when overexpressed in transgenic mice, and lowers blood glucose and triglyceride levels when therapeutically administered to diabetic rodents. Fibroblast Growth Factor-21 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 183aa including N-terminal Methionine and having a molecular mass of 20.1kD. The aa sequence of the recombinant mouse FGF21 is 100% homologous to the aa sequence of the mouse FGF21 without signal sequence. The FGF-21 is purified by proprietary chromatographic techniques. | | | Catalog # | F4212-93J | | Source | Recombinant corresponding to mouse FGF-21 expressed in E. coli. | | AA Sequence | MAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPG VIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSP NQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS | | Molecular Weight | ~20.1kD | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | ~20.1kD | | Source | E. coli | | Purity | ~95% (SDS-PAGE, HPLC) | | Concentration | Not determined | | Form | Supplied as a lyophilized powder from 20mM Tris, pH 7.4, 20mM sodium chloride. Reconstitute with sterile dH2O to 100ug/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
