Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Growth Factors, Cytokines » Growth Factors-FGF » Fibroblast Growth Factor 21, Recombinant, Mouse (FGF-21, Fgf21)

Fibroblast Growth Factor 21, Recombinant, Mouse (FGF-21, Fgf21)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

The FGFs are a family of more than 20 small (~17–26kD) secreted peptides. The initial characterization of these proteins focused on their ability to stimulate fibroblast proliferation. FGFs modulate cellular activity via at least 5 distinct subfamilies of high-affinity FGF receptors (FGFRs): FGFR-1, -2, -3, and -4, all with intrinsic tyrosine kinase activity and, except for FGFR-4, multiple splice isoforms, and FGFR-5, which lacks an intracellular kinase domain. There is growing evidence that FGFRs can be important for regulation of glucose and lipid homeostasis. FGFR-2 appears to be a key molecule during pancreatic development and FGFR-4 has been implicated in cholesterol metabolism and bile acid synthesis. FGF-21 is preferentially expressed in liver, but an exact knowledge of FGF-21 bioactivity and its mode of action have been lacking to date. FGF-21 is a potent activator of glucose uptake on adipocytes, protects animals from diet-induced obesity when overexpressed in transgenic mice, and lowers blood glucose and triglyceride levels when therapeutically administered to diabetic rodents. Fibroblast Growth Factor-21 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 183aa including N-terminal Methionine and having a molecular mass of 20.1kD. The aa sequence of the recombinant mouse FGF21 is 100% homologous to the aa sequence of the mouse FGF21 without signal sequence. The FGF-21 is purified by proprietary chromatographic techniques.
Catalog #F4212-93J
SourceRecombinant corresponding to mouse FGF-21 expressed in E. coli.
AA SequenceMAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPG VIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSP NQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Molecular Weight~20.1kD
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight~20.1kD
SourceE. coli
Purity~95% (SDS-PAGE, HPLC)
ConcentrationNot determined
FormSupplied as a lyophilized powder from 20mM Tris, pH 7.4, 20mM sodium chloride. Reconstitute with sterile dH2O to 100ug/ml.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links