You are here:Home
»
BioSeparation?
»
BioSep-Assay Detection, Tags
»
Green Fluorescent Protein, Enhanced (Aequorea Victoria) (GFP)
Green Fluorescent Protein, Enhanced (Aequorea Victoria) (GFP)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin. Fluorescent proteins have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. | | | Catalog # | G8965-14B | | AA Sequence | : Histidine-V5 epitope fused to EGFP MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFTVSK GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK MVLLEFVTAAGITLGMDELYK | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | ~30kD | | Source | E. coli | | Purity | 90% by SDS-PAGE | | Concentration | As reported | | Form | Supplied as a lyophilized powder. Reconstitute with 100ul sterile ddH2O. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. | | Alternate names | Enhanced Green Fluorescent Protein |
External Links
|