Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Rat GRO-ß (Rat MIP2) promotes neutrophil chemotaxis and degranulation. Rat GROß is a 7.9kD protein containing 73 amino acid residues.
Catalog #	G8975-21
Source	E. coli
Form	Lyophilized protein with no additives.
Stability	The lyophilized protein, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted rat GRO-ß should be stored in working aliquots at -20°C.
Purity	Greater than 98% by SDS-PAGE and HPLC analyses.
Endotoxin	0.1ng/ug
Reconstitution	Lyophilized rat GRO-ß is soluble in water and most aqueous buffers. The lyophilized protein should be reconstituted in water to a concentration of 100 ng/ul. This solution can be diluted into water or other buffered solutions or stored at -20°C for future use.
Biological Activity	The maximal chemotactic activity of rat GRO-ß on rat neutrophils as assayed in a modified Boyden chamber was achieved at 50ng/ml.
Responding Cells (partial list)	Neutrophils
Concentration Range for most in vitro applications	10-100ng/ml
AA Sequence	VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
Country of Origin	USA
Molecular Weight	7.9kD
Source	Rat
Important Note	This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.