You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-GRO
»
GRO9, Recombinant, Human (CXCL9, Chemokine (C-X-C motif) ligand 9, CMK, crg-10, C-X-C motif chemokine 9, Gamma-interferon-induced monokine, Humig, MIG, SCYB9, Small-inducible cytokine)
GRO9, Recombinant, Human (CXCL9, Chemokine (C-X-C motif) ligand 9, CMK, crg-10, C-X-C
motif chemokine 9, Gamma-interferon-induced monokine, Humig, MIG, SCYB9, Small-inducible
cytokine)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| CXCL9, a member of the subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system specifically in response to IFN- . CXCL9 has been shown to be a chemoattractant for activated T-lymphocytes and TIL but not for neutrophils or monocytes. The human CXCL9 cDNA encodes a 125 amino acid residue precursor protein with a 22 amino acid residue signal peptide that is cleaved to yield a 103 amino acid residue mature protein. CXCL9 has an extended carboxy-terminus containing greater than 50% basic amino acid residues and is larger than most other chemokines. A chemokine receptor (CXCR3) specific for CXCL9 and IP-10 has recently been cloned and shown to be highly expressed in IL-2-activated T-lymphocytes. | | | Catalog # | G8975-86R | | Biological Activity | Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10.0-100.0ng/ml. | | AA Sequence | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSA | | DVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT | | Endotoxin | 1EU/ug as determined by LAL method. | | Storage and Stability | Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months. | | Molecular Weight | 11.7 kD | | Source | Escherichia coli | | Purity | ~97% by SDS-PAGE and HPLC analyses. | | Concentration | 1mg/ml | | Form | Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
|
|
Questions or comments about this product? Inquire here. |
|
|
Download Specifications for GRO9, Recombinant, Human (CXCL9, Chemokine (C-X-C motif) ligand 9, CMK, crg-10, C-X-C motif chemokine 9, Gamma-interferon-induced monokine, Humig, MIG, SCYB9, Small-inducible cytokine) |
External Links
|
