You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-Fraktaline
»
GRO10, Recombinant, Human, (CXCL10, C-X-C Chemokine Ligand 10)
GRO10, Recombinant, Human, (CXCL10, C-X-C Chemokine Ligand 10)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| IP-10 was originally identified as an IFN- -inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1b, TNF-a, IL-12 and viruses. Additional cell types that have been shown to express IP-10 include activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells. IP-10 is also expressed in psoriatic and lepromatous lesions of skin. The mouse homologue of human IP-10, Crg-2, has been cloned andshown to share approximately 67% amino acid sequence identity with human IP-10. | | | Catalog # | G8975-86S | | Biological Activity | Fully biologically active when compared to standard. Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 10.0-100.0ng/ml. | | AA Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPES | | KAIKNLLKAVSKEMSKRSP | | Endotoxin | 1EU/ug as determined by LAL method. | | Storage and Stability | Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months. | | Molecular Weight | 8.5 kD | | Source | Escherichia coli | | Purity | ~97% by SDS-PAGE and HPLC analyses. | | Concentration | 1mg/ml | | Form | Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
