Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Homeobox (HOX) » Anti -Hox 10 (Ceh 10 Homeodomain Containing Homolog (C. elegans), CHX10, Homeobox Protein CHX10, MCOP2, MCOPCB3, RET1, Vsx2)

Anti -Hox 10 (Ceh 10 Homeodomain Containing Homolog (C. elegans), CHX10, Homeobox Protein
CHX10, MCOP2, MCOPCB3, RET1, Vsx2)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Sheep Purified B
Catalog #H7022-32
ApplicationsSuitable for use in Western Blot. Other applications not tested.
Recommended DilutionWestern Blot: 0.5-1ug/ml. Detects a band of approximately 46kD in mouse and rat retinal tissue lysates.
Optimal dilutions to be determined by the researcher.
Cellular Localization Nuclear
Positive Control Rat or mouse retinal tissue lysate.
Storage and StabilityMay be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot Store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
IsotypeIgG
HostSheep
SourceHuman
Concentration~1mg/ml
FormSupplied as a liquid in PBS, containing 0.08% sodium azide.
PurityPurified
ImmunogenRecombinant fragment: EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA, corresponding to C terminal amino acids 264-361 of Human CHX10
SpecificityRecognizes human HOX10. Species Crossreactivity: Mouse, rat and bovine.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links