You are here:Home
»
Antibodies
»
Abs to Homeobox (HOX)
»
Anti -Hox 10 (Ceh 10 Homeodomain Containing Homolog (C. elegans), CHX10, Homeobox Protein CHX10, MCOP2, MCOPCB3, RET1, Vsx2)
Anti -Hox 10 (Ceh 10 Homeodomain Containing Homolog (C. elegans), CHX10, Homeobox Protein
CHX10, MCOP2, MCOPCB3, RET1, Vsx2)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Sheep |
Purified |
B |
|
| Catalog # | H7022-32 | | Applications | Suitable for use in Western Blot. Other applications not tested. | | Recommended Dilution | Western Blot: 0.5-1ug/ml. Detects a band of approximately 46kD in mouse and rat retinal tissue lysates. | | Optimal dilutions to be determined by the researcher. | | Cellular Localization | Nuclear | | Positive Control | Rat or mouse retinal tissue lysate. | | Storage and Stability | May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot Store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | CAS Number | n/a | | Clone Type | Polyclonal | | Isotype | IgG | | Host | Sheep | | Source | Human | | Concentration | ~1mg/ml | | Form | Supplied as a liquid in PBS, containing 0.08% sodium azide. | | Purity | Purified | | Immunogen | Recombinant fragment: EAAAEKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA, corresponding to C terminal amino acids 264-361 of Human CHX10 | | Specificity | Recognizes human HOX10. Species Crossreactivity: Mouse, rat and bovine. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
