You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-IGF
»
Insulin-Like Growth Factor I, Recombinant, Human (IGF1, IGF I)
Insulin-Like Growth Factor I, Recombinant, Human (IGF1, IGF I)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Insulin Like Growth Factor-I (IGF-I) is a polypeptide growth factor which stimulates the proliferation of a wide range of cell types including muscle, bone, and cartilage tissue. Recombinant Human IGF-I is a single, nonglycosylated, 7.6kD protein containing 70 amino acid residues. Insulin-like growth factor 1 (IGF-I) is involved in regulation of neuronal growth and development in central and peripheral nervous system. It is known to protect neurons against cell death induced by amyloidogenic derivatives, glucose or serum | | | deprivation through pathways involving AKT kinase and transcription factor FKHRL1 phosphorylation. Activation of the insulin-like growth factor system has emerged as a key factor for tumor progression and resistance to apoptosis in many cancers like breast and thyroid cancers. | | | Catalog # | I7661-11D | | AA Sequence | GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY CAPLKPAKSA | | Biological Activity | 1-7ng/ml. Measured in cell proliferation assay with NIH3T3 cells | | Storage and Stabiltiy | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | 7.6kD | | Source | Recombinant, Human (E. coli) | | Purity | ~98% by SDS-PAGE and HPLC analyses. Endotoxin: | | 0.1ng/ug. | | Form | Supplied as a lyophilized powder with no additives. Reconsitute in sterile ddH2O to a concentration of 0.1-1mg/ml. Also available as a liquid. See I7661-11C. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
