Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Integrin » Anti -Integrin alpha 3A

Anti -Integrin alpha 3A

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Monoclonal Mouse Affinity Purified B IH IC
Several major families of cell adhesion molecules can be distinguished. These include the cadherins and N-CAMs, which play a crucial role in cell recognition and adhesion, while integrins are implicated in the adherence of cells to the extracellular matrix.
Catalog #I7661-33H
Cadherins constitute a family of proteins, the members of which are differentially expressed in the different tissues. One of the best characterized members is E-cadherin, which is prevalent in epithelial tissues. It has been shown to play a crucial role in the process of tumor cell metastasis. NCAMís (neural cell adhesion molecules) exist in at least three forms of plasma membrane plycoproteins, which are expressed in a variety of tissues including most nerve cells.
The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha- and a beta-subunit in interconnecting the cytoskeleton and the extracellular matrix.
ApplicationsSuitable for use in Immunohistochemistry (frozen sections), Immunocytochemistry and Western Blot. Other applications not tested.
Recommended DilutionImmunohistochemistry (frozen): 1:100 -1:200 using avidn-biotinylated HRP complex (ABC) as detection reagent.
Western Blot: 1:100 - 1:1000
Optimum dilutions to be determined by researcher.
Storage and StabilityMay be stored at 4°C for short-term only. For long-term storage, store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypeMonoclonal
IsotypeIgG1
Clone No29A3
HostMouse
SourceHuman
Concentration~1mg/ml
FormSupplied as a liquid in PBS, pH 7.2, 0.1% sodium azide. No stabilizing proteins added.
PurityPurified by Protein G affinity chromatography.
ImmunogenSynthetic peptide corresponding to the cytoplasmic domain of the integrin subunit 3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
SpecificityRecognizes specifically the cytoplasmic domain of human integrin subunit 3A which is present in the basal cell layer in skin, glomeruli, Bowmanís capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links