
Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Integrin » Anti -Integrin alpha 3B

Anti -Integrin alpha 3B


  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.


Clone Host Grade Applications
Monoclonal Mouse Affinity Purified B IH IC
Several major families of cell adhesion molecules can be distinguished. These include the cadherins and N-CAMs, which play a crucial role in cell recognition and adhesion, while integrins are implicated in the adherence of cells to the extracellular matrix.
Catalog #I7661-33K
Cadherins constitute a family of proteins, the members of which are differentially expressed in the different tissues. One of the best characterized members is E-cadherin, which is prevalent in epithelial tissues. It has been shown to play a crucial role in the process of tumor cell metastasis. NCAMís (neural cell adhesion molecules) exist in at least three forms of plasma membrane plycoproteins, which are expressed in a variety of tissues including most nerve cells.
The integrins, finally, form a large family of glycosylated transmembrane proteins that act as dimers of an alpha- and a beta-subunit in interconnecting the cytoskeleton and the extracellular matrix.
ApplicationsSuitable for use in Immunohistochemistry (frozen sections), Immunocytochemistry and Western Blot. Other applications not tested.
Recommended DilutionImmunohistochemistry (frozen): 1:25 -1:200 using avidn-biotinylated HRP complex (ABC) as detection reagent.
Western Blot: 1:100 - 1:1,000
Optimum dilutions to be determined by researcher.
Storage and StabilityMay be stored at 4°C for short-term only. For long-term storage, store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypeMonoclonal
Clone No54B3
FormSupplied as a liquid in PBS, pH 7.2, 0.1% sodium azide. No stabilizing proteins added.
PurityPurified by Protein G affinity chromatography.
ImmunogenSynthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin 3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to KLH
SpecificityRecognizes specifically the cytoplasmic domain of human integrin subunit 3B which is present in microvascular structures in brain and heart. Broad species crossreactivity is expected because of the conserved nature of the epitope.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links