You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-Interleukin
»
Interleukin 10, Recombinant, Mouse (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF)
Interleukin 10, Recombinant, Mouse (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Interleukin-10 (IL-10), originally known as Cytokine Synthesis Inhibitory Factor (CSIF), is an 18.7kD protein that shares over 80% sequence homology with the Epstein-Barr Virus protein BCRFI. The reported biological activities of IL-10, which may be inter-related, include inhibition of macrophage mediated cytokine synthesis, suppression of the delayed type hyper-sensitivity response, and stimulation of the Th2 cell response which results in elevated antibody production. | | | Source: E. coli | | | Form: Supplied as a lyophilized powder in 10mM PBS, pH 7.0. | | | Purity: 98% by SDS-PAGE and HPLC analysis. | | | Endotoxin: 0.1 ng/ug | | | Reconstitution: Reconstitute in 3mM Tris, pH 8.0 to a concentration of 0.1-1mg/ml. This solution can then be diluted into other aqueous solutions. | | | Storage and Stability: Lyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding ddH2O, aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | | Biological Activity: Murine IL-10 is fully biologically active when compared to standards. The ED50 as determined by the dose-dependent co-stimulation (with IL-4) of the proliferation of murein MC-9 cells is 2ng/ml, corresponding to a specific activity of 5x10e5 units/mg. | | | Responding Cells (partial list): | | | T cells, macrophages | | | AA Sequence: | | | MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGY LGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS | | | Country of Origin: | | | USA | | | Catalog # | I8432-10 | | Molecular Weight | 18.7kD | | Source | E coli | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
