You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-Interleukin
»
Interleukin 10, Recombinant, Mouse (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF)
Interleukin 10, Recombinant, Mouse (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| IL-10 is an immunosuppressive cytokine produced by a variety of mammalian cell types including macrophages, monocytes, T cells, B cells and keratinocytes. IL-10 inhibits the expression of proinflammatory cytokines such as IL-1 and TNF . Like IL-4, IL-10 enhances humoral immune responses and attenuates cell-mediated immune reactions. Human IL-10 active on murine cells, but murine IL-10 is inactive on human cells. Recombinant murine IL-10 is an 18.7kDa protein of 161 amino acid residues. | | | Catalog # | I8432-13R | | Protein Sequence | MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSFNLEDQGVYKAMNEFDIFINCIEAYMMIKMKS | | Source | Escherichia coli. | | Biological Activity | Murine IL-10 is fully biologically active as measured by the dose-dependent co-stimulation (with IL-4) of the proliferation of murine MC/9 cells. The ED50 was found to be 2ng/ml, corresponding to a specific activity of 5x10e5 units/mg. | | Endotoxin | 1EU/ug (LAL) | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 6 months at -20°C. Reconstitute with sterile ddH2O. Aliquot and store at -20°C. Reconstituted product is stable for 1 month at 4 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | ~18.7kD | | Source | E. coli | | Purity | 95% as determined by SDS-PAGE and HPLC. | | Form | Supplied as a lyophilized powder from a 0.2um filtered solution in PBS, 50ug of HSA per 1ug of cytokine. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|