You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-Interleukin
»
Interleukin 17A/F Heterodimer, Recombinant, Human (IL-17, CTLA8, IL-17A, Interleukin-17A Precursor, Cytotoxic T-lymphocyte-associated Antigen 8)
Interleukin 17A/F Heterodimer, Recombinant, Human (IL-17, CTLA8, IL-17A, Interleukin-17A
Precursor, Cytotoxic T-lymphocyte-associated Antigen 8)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Human IL-17A/F is a 40kD glycoprotein which is secreted as a disulfide-linked heterodimer. IL-17A/F consists of two proteins, IL-17A and IL17F. Human IL17A is produced as a 155aa precursor that includes a 23aa signal sequence and a 132aa chain that includes an N-linked glycosylation site. Human IL17F is produced as a 153aa precursor with a 20aa signal sequence and a 133aa region and an N-linked glycosylation site. Both proteins (IL17A & IL17F) share 50% aa sequence identity. Human IL17A and IL17F show approximately 60% homology in their aa sequence to mouse IL-17A and IL-17F. Interleukin-17A/F and IL17A, IL17F homodimers are manufactured by activted CD4+ T cells, called Th17. IL-23 causes Th17 lymphocytes to manufacture IL-17A/F. Interleukin-17A/F induces chemokine production and airway neutrophilia with intermediate potency between IL17A (most potent) and IL17F (least potent). IL-17A/F Human Recombinant produced in E. coli is a heterodimeric, non-glycosylated polypeptide chain containing 1 monomeric subunit of each IL-17A and IL-17F. The active dimer contains 271aa and having a total molecular mass of 30.7kD. The IL-17A/F Human is purified by proprietary chromatographic techniques. | | | Catalog # | I8439-02R | | Source | Recombinant corresponding to human IL-17A/F expressed in E. coli. | | AA Sequence | MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPE-RYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGH-TFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISM-NSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ | | Molecular Weight | ~30.7kD | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | ~30.7kD | | Source | E. coli | | Purity | ~98% (SDS-PAGE, HPLC) | | Concentration | Not determined | | Form | Supplied as a lyophilized powder. Reconstitute with sterile dH2O to 1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
