Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Molecular Biology » Growth Factors-Interleukin » Interleukin 17A/F Heterodimer, Recombinant, Human (IL-17, CTLA8, IL-17A, Interleukin-17A Precursor, Cytotoxic T-lymphocyte-associated Antigen 8)

Interleukin 17A/F Heterodimer, Recombinant, Human (IL-17, CTLA8, IL-17A, Interleukin-17A
Precursor, Cytotoxic T-lymphocyte-associated Antigen 8)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Human IL-17A/F is a 40kD glycoprotein which is secreted as a disulfide-linked heterodimer. IL-17A/F consists of two proteins, IL-17A and IL17F. Human IL17A is produced as a 155aa precursor that includes a 23aa signal sequence and a 132aa chain that includes an N-linked glycosylation site. Human IL17F is produced as a 153aa precursor with a 20aa signal sequence and a 133aa region and an N-linked glycosylation site. Both proteins (IL17A & IL17F) share 50% aa sequence identity. Human IL17A and IL17F show approximately 60% homology in their aa sequence to mouse IL-17A and IL-17F. Interleukin-17A/F and IL17A, IL17F homodimers are manufactured by activted CD4+ T cells, called Th17. IL-23 causes Th17 lymphocytes to manufacture IL-17A/F. Interleukin-17A/F induces chemokine production and airway neutrophilia with intermediate potency between IL17A (most potent) and IL17F (least potent). IL-17A/F Human Recombinant produced in E. coli is a heterodimeric, non-glycosylated polypeptide chain containing 1 monomeric subunit of each IL-17A and IL-17F. The active dimer contains 271aa and having a total molecular mass of 30.7kD. The IL-17A/F Human is purified by proprietary chromatographic techniques.
Catalog #I8439-02R
SourceRecombinant corresponding to human IL-17A/F expressed in E. coli.
AA Sequence MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPE-RYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGH-TFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISM-NSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Molecular Weight~30.7kD
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight~30.7kD
SourceE. coli
Purity~98% (SDS-PAGE, HPLC)
ConcentrationNot determined
FormSupplied as a lyophilized powder. Reconstitute with sterile dH2O to 1mg/ml.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links