Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Growth Factors, Cytokines » Growth Factors-Interleukin » Interleukin 17E, Recombinant, Mouse (IL-17E, Interleukin-25, IL-25, Interleukin-17E, IL25, IL17E)

Interleukin 17E, Recombinant, Mouse (IL-17E, Interleukin-25, IL-25, Interleukin-17E, IL25,
IL17E)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Mouse IL-17E (IL-25), is a proinflammatory cytokine member of a six-species family of proteins (IL-17A-17F). Mouse IL-17E protein is a homodimer consisting of two 153aa peptides. Recombinant mouse IL-17E produced in E. coli is a non-glycosylated disulfide-joined homodimer having a molecular mass of 34.9kD
Catalog #I8439-21B
SourceRecombinant corresponding to mouse IL-17E expressed in E. coli.
AA SequenceVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSR AISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCH GEEGTHRRYCLERRLYRVSLACVCVRPRVMA
Molecular Weight~34.9kD
Endotoxin Level< 0.01ng/ug
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight~34.9kD
SourceE. coli
Purity~95% (SDS-PAGE, HPLC)
ConcentrationNot determined
FormSupplied as a lyophilized powder. Reconstitute with 5mM acetic acid to 0.1mg/ml.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links