You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-Interleukin
»
Interleukin 17E, Recombinant, Mouse (IL-17E, Interleukin-25, IL-25, Interleukin-17E, IL25, IL17E)
Interleukin 17E, Recombinant, Mouse (IL-17E, Interleukin-25, IL-25, Interleukin-17E, IL25,
IL17E)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Mouse IL-17E (IL-25), is a proinflammatory cytokine member of a six-species family of proteins (IL-17A-17F). Mouse IL-17E protein is a homodimer consisting of two 153aa peptides. Recombinant mouse IL-17E produced in E. coli is a non-glycosylated disulfide-joined homodimer having a molecular mass of 34.9kD | | | Catalog # | I8439-21B | | Source | Recombinant corresponding to mouse IL-17E expressed in E. coli. | | AA Sequence | VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSR AISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCH GEEGTHRRYCLERRLYRVSLACVCVRPRVMA | | Molecular Weight | ~34.9kD | | Endotoxin Level | < 0.01ng/ug | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | ~34.9kD | | Source | E. coli | | Purity | ~95% (SDS-PAGE, HPLC) | | Concentration | Not determined | | Form | Supplied as a lyophilized powder. Reconstitute with 5mM acetic acid to 0.1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
