Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Molecular Biology » Growth Factors-Interleukin » Interleukin 17F, Recombinant, Mouse (IL-17F, Interleukin-17F, IL17F)

Interleukin 17F, Recombinant, Mouse (IL-17F, Interleukin-17F, IL17F)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Homodimeric interleukin-17F is a member of the IL-17 family of six homodimeric proteins (IL-17A-17F). Activated CD4+ T cells have also been shown to produce Mouse IL-17F. Activity studies reveal IL-17A to be the most potent, followed by IL-17A/F and IL-17F 100 fold lower than IL-17A. Recombinant Mouse IL-17F produced in E. coli is a non-glycosylated polypeptide comprised of two monomeric subunit each of mIL-17F. The dimer consists of 266aa, with an approximate molecular weight of 29.8kD
Catalog #I8439-30C
SourceRecombinant coreesponding to mouse IL-17F expressed in E. coli.
AA SequenceRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDP HRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKV GCTCVKPIVHQAA
Molecular Weight~29.8kD
Endotoxin Level<0.01ng/ug
Biological ActivityIL-17F is fully bioactive when compared to standard. The ED50 as determined by the dose-dependent induction of IL-6 in NHDF is 1.94ng/ml.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight~29.8kD
SourceE. coli
Purity~98% (SDS-PAGE, HPLC)
ConcentrationNot determined
FormSupplied as a lyophilized powder. Reconstitute with sterile dH2O to 0.1mg/ml.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links