You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-Interleukin
»
Interleukin 17F, Recombinant, Mouse (IL-17F, Interleukin-17F, IL17F)
Interleukin 17F, Recombinant, Mouse (IL-17F, Interleukin-17F, IL17F)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Homodimeric interleukin-17F is a member of the IL-17 family of six homodimeric proteins (IL-17A-17F). Activated CD4+ T cells have also been shown to produce Mouse IL-17F. Activity studies reveal IL-17A to be the most potent, followed by IL-17A/F and IL-17F 100 fold lower than IL-17A. Recombinant Mouse IL-17F produced in E. coli is a non-glycosylated polypeptide comprised of two monomeric subunit each of mIL-17F. The dimer consists of 266aa, with an approximate molecular weight of 29.8kD | | | Catalog # | I8439-30C | | Source | Recombinant coreesponding to mouse IL-17F expressed in E. coli. | | AA Sequence | RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDP HRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKV GCTCVKPIVHQAA | | Molecular Weight | ~29.8kD | | Endotoxin Level | <0.01ng/ug | | Biological Activity | IL-17F is fully bioactive when compared to standard. The ED50 as determined by the dose-dependent induction of IL-6 in NHDF is 1.94ng/ml. | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | ~29.8kD | | Source | E. coli | | Purity | ~98% (SDS-PAGE, HPLC) | | Concentration | Not determined | | Form | Supplied as a lyophilized powder. Reconstitute with sterile dH2O to 0.1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
