You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-Interleukin
»
Interleukin 22, Recombinant, Rat (IL-22, IL-10 Related T cell-derived Inducible Factor, IL-TIF)
Interleukin 22, Recombinant, Rat (IL-22, IL-10 Related T cell-derived Inducible Factor,
IL-TIF)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Rat Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. It belongs to the IL-10-related cytokine family that consists of six members (IL-10, IL-19, IL-20, IL-22, IL-24/MDA-7 and IL-26/AK155). These proteins share structural homology and some degree of amino acid sequence homology to IL-10. Receptors for these proteins are members of the class II cytokine receptor family. The rat IL-22 coding region corresponding to amino acids 48-179 was deduced from a rat genomic clone (Genbank accession #AC111483). The N-terminal portion was cloned from rat adipocyte first strands using degenerate forward primers based on the human and mouse IL-22 amino acid sequences in two independent PCR reactions. Rat IL-22 cDNA predicts a 179aa residue precursor protein with a putative 33aa signal peptide that is cleaved to generate a 147aa mature protein, which shares ~92% and 79% aa sequence identity with mouse and human IL-22, respectively. IL-22 signals through a heterodimeric receptor complex composed of the IL-22R (CRF2-9) subunit and the b chain of IL-10R. In addition, IL-22 also binds to a secreted member of the class II cytokine receptor family called IL-22BP that acts as a natural IL-22 antagonist. IL-22 upregulates acute-phase reactants in the liver and hepatoma cells. In a rat hepatoma cell line, IL-22 has been shown to activate the Jak/STAT and MAPK signaling pathways. | | | Catalog # | I8443-17 | | Source | A DNA sequence encoding the putative mature rat Interleukin 22 protein sequence expressed in E. coli. | | Amino Acid Sequence | MLPINSQCKLEAANFQQPYIVNRTFMLAKEASLADNNTDVRLIGEELFRGVKAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSIHLSPCHISGDDQNIQKNVRQLKETVQKLGESGEIKAIGELDLLFMSLR NACV | | Molecular Mass | The methionyl form of recombinant rat IL-22 has a predicted molecular mass of ~16.7kD. | | Activity | Measured by its ability to induce IL-10 secretion in Colo205 cells. The ED50 is typically 150-750pg/ml. | | Form: Lyophilized from a 0.2um filtered solution in PBS containing 50ug of BSA per | | 1ug of cytokine. | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile PBS, 0.1% HSA or BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | ~16.7kD | | Purity | > 97% as determined by SDS-PAGE and visualized by silver stain. Endotoxin: <1EU/ug (LAL) | | Concentration | As reported | | Form | Supplied as a lyophilized powder from PBS, BSA. | | Reconstitute with sterile PBS, 0.1% HSA or BSA to prepare a stock solution of 10ug/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
