You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-KGF
»
Keratinocyte Growth Factor-1, Recombinant Human (KGF-1, Fibroblast Growth Factor 7, FGF-7)
Keratinocyte Growth Factor-1, Recombinant Human (KGF-1, Fibroblast Growth Factor 7, FGF-7)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Keratinocyte Growth Factor-1 (KGF-1/FGF-7) is one of 23 known members of the FGF family. All FGFs have two conserved cysteine residues and share 30-50% sequence identity at the amino acid level. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of variety of tissues, by promoting cellular proliferation and differentiation. KGF-1/FG-7 is a mitogen factor specific for epithelial cells and keratinocytes and signals through FGFR 2b. KGF-1/FGF-7 plays a role in kidney and lung development, angiogenesis, and wound healing. | | | Catalog # | K0201-15B | | Amino Acid Sequence | MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQK GIPVRGKKTK KEQKTAHFLPMAIT | | Biological Activity | The biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing KGF receptors yielding an ED50 <10ng/ml, corresponding to a specific activity of 1x10e5 units/mg. | | Endotoxin | 1EU/ug as determined by LAL method. | | Storage and Stability | Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months. | | Storage and Stability | Lyophilized powder may be stored at -20°C. Reconstituted product is stable for up to one week at 4°C. For maximal stability, apportion reconstituted material into working aliquots and store at -20°C to -70°C. Avoid freeze-thaw cycles. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | ~19.0 kD | | Source | Escherichia coli | | Purity | 96% by SDS-PAGE and HPLC analyses. | | Form | Supplied as a lyophilized powder in PBS, pH 8.0. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
