Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Enzymes, Glycosidase » Anti -Lysozyme-like 6 (Lysozyme Homolog, 1700023H08Rik, LOC57151, LYC1, LYZL6, PRO1485, RGD1306968, TKAL754)

Anti -Lysozyme-like 6 (Lysozyme Homolog, 1700023H08Rik, LOC57151, LYC1, LYZL6, PRO1485,
RGD1306968, TKAL754)

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Clone Host Grade Applications
Polyclonal Rabbit Affinity Purified IH
LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.
Catalog #L9202-01
ApplicationsSuitable for use in Immunohistochemistry. Other applications not tested.
Recommended DilutionImmunohistochemistry: Formalin-fixed, paraffin-embedded sections. Most normal tissues and malignant tissues were negative. Subsets of cells in seminiferus ducts expressed strong cytoplasmic positivity while the urothelium displayed moderate staining. Placenta, some of the glandular cells in gastrointestinal tract, epididymis and seminal vesicles showed weak staining. Occasional malignant carcinoids, urothelial and colorectal cancers showed weak to moderate staining.
Optimal dilutions to be determined by the researcher.
Storage and StabilityMay be stored at 4°C for short-term only. For long-term storage, store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
ConcentrationNot determined
FormSupplied as a liquid in PBS, pH 7.2, 40% glycerol, 0.02% sodium azide.
PurityPurified by immunoaffinity chromatography.
ImmunogenLysozyme-like protein 6 Precursor recombinant protein epitope signature tag (PrEST), immunogen sequence CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP
SpecificityRecognizes human Lysozyme-like 6.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links