You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-MCP
»
Macrophage Inflammatory Protein 4, Recombinant, Human (MIP4)
Macrophage Inflammatory Protein 4, Recombinant, Human (MIP4)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| CCL18, is a novel CC chemokine that is highly homologous to MIP-1a (61% amino acid sequence identity). CCL18 cDNA encodes an 89 aa residue precursor protein with a 20 aa putative signal peptide that is cleaved to generate a 69 aa residue mature protein which lacks potential glycosylation sites. In vitro, CCL18 mRNA expression is induced in alternatively activated macrophages by Th2 cytokines such as IL-4, IL-10 and IL-13, and inhibited by IFN-y. CCL18 mRNA is also expressed by GM-CSF/IL-4-induced monocyte-derived dendritic cells. In vivo, CCL18 is highly expressed in lung and placenta but is not expressed in epidermal Langerhans cells. Recombinant CCL18 has been shown to chemoattract naive T cells, but not monocytes or neutrophils. | | | Catalog # | M1202-73M | | Biological Activity | Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 1.0 -10.0 ng/ml. | | AA Sequence | AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKK | | WVQKYISDLKLNA | | Endotoxin | 1EU/ug as determined by LAL method. | | Storage and Stability | Aliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months. | | Molecular Weight | 7.8 kD | | Source | Escherichia coli | | Purity | ~97% by SDS-PAGE and HPLC analyses. | | Concentration | 1mg/ml | | Form | Supplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|