Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Growth Factors, Cytokines » Growth Factors-MIP » MCP2, Recombinant, Human (Macrophage/Monocyte Chemotactic Protein 2, Chemokine C-C Motif Ligand 8, CCL8, HC14, Monocyte Chemotactic Protein 2, Small Inducible Cytokine A8 Precursor, SCYA8, SCYA10)

MCP2, Recombinant, Human (Macrophage/Monocyte Chemotactic Protein 2, Chemokine C-C Motif
Ligand 8, CCL8, HC14, Monocyte Chemotactic Protein 2, Small Inducible Cytokine A8
Precursor, SCYA8, SCYA10)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

MCP-2 and MCP-3 are two recently identified monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the C-C family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1. MCP-3 also shares 58% amino acid identity with MCP-2.
Similarly to other C-C chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes. All three cytokines have also been shown to attract eosinophils and induce histamine secretion from basophils.
Catalog #M2750-11D
Biological ActivityFully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood monocytes using a concentration range of 10.0 -100.0 ng/ml.
AA Sequence QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCAD
PKERWVRDSMKHLDQIFQNLKP
Endotoxin 1EU/ug as determined by LAL method.
Storage and StabilityAliquot to avoid repeated freezing and thawing and freeze at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 12 months.
Molecular Weight8.9 kD
SourceEscherichia coli
Purity~96% by SDS-PAGE and HPLC analyses.
Concentration1mg/ml
FormSupplied as a lyophilized powder in PBS, pH 7.5. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1mg/ml.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links