Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Growth Factors, Cytokines » Growth Factors-Other » Neuregulin 1, Recombinant, Human (NRG1, NDF)

Neuregulin 1, Recombinant, Human (NRG1, NDF)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Neuregulin is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells, playing an important role in heart structure and function through inducing ErbB2/ErbB4 receptor phosphorylation and cardiomyocyte differentiation. Research on molecular level discovered that recombinant neuregulin could make disturbed myocardial cell structure into order and strengthen the connection between myocardial cells by intercalated discs re-organization. Pharmacodynamic experiments in animals showed that recombinant neuregulin (NRG1) can reduce the degree of damage on myocardial cells caused by ischemia, hypoxia and viral infection.
Catalog #N2108-75
DescriptionRecombinant Human Neuroregulin-1 (Neu differentiation factor) produced in E. coli is a single, non-glycosylated polypeptide chain containing 61 amino acids having a molecular mass of 7055D. Recombinant Human NRG1 is purified by proprietary chromatographic techniques.
Amino Acid Sequence SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ
Biological ActivityThe activity measured by its ability to stimulate the proliferation of human MCF-7 cells grown under serum-free conditions corresponding to a specific activity of 1.2x10e4 units/mg.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight7.1kD
SourceEscherichia coli
Purity95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.
FormSupplied as a lyophilized powder from 20mM phosphate buffer, pH 7.4, 150mM sodium chloride. Reconstitute with sterile ddH2O, to a concentration of 100ug/ml.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links