You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-NGF
»
Nerve Growth Factor, pro, Recombinant, Human (NGF)
Nerve Growth Factor, pro, Recombinant, Human (NGF)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| ProNGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein proNGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer. Recombinant Human Pro-NGF produced in E.coli is a non-glycosylated, polypeptide chain containing 222 amino acids and having a molecular mass of 49,738 Dalton. | | | Recombinant Pro-NGF is purified by proprietary chromatographic techniques. | | | Catalog # | N2350-09H | | Amino-Acid Sequence | MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVL | | FSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVM | | VLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTA | | CVCVLSRKAVR. | | Biological Activity | The activity of the protein can by measured by its stimulating effect on the proliferation of TF1 cells (Chevalier et al. 1994 Blood 83, 1479-85). | | EC50 130 ± 30 pM (TF1 cell assay) | | Endotoxin | 0.05 EU/ug of reconbinant human Pro-NGF. | | Storage and Stability | May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing.. Store at -20°C. Aliquots are stable for at least 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | 49.74kD | | Source | Recombinant, Human (E. coli) | | Purity | 98% as determined by RP-HPLC .and by reducing and non-reducing SDS-PAGE Silver Stained gel. Endotoxin: 0.05 EU/ug. | | Concentration | ~1mg/ml | | Form | Supplied as a liquid in PBS, pH 7.2. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|