You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-Neurotrophins
»
Pleiotrophin, Recombinant, Human (PTN, HARP, Heparin Affin Regulatory Peptide)
Pleiotrophin, Recombinant, Human (PTN, HARP, Heparin Affin Regulatory Peptide)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Human Pleiotrophin (PTN) also called HARP (Heparin affin regulatory peptide) is a new member of the heparin-binding neurotrophic factor family. PTN (Pleiotrophin) and MK (Midkine) are structural homologs, and are highly conserved among species. PTN plays an important role in development processess and promotion of neurite extension. Recombinant PTN is a 13.4 kD protein, comprising of 136 amino acid residues. | | | Catalog # | P4214-50 | | AA Sequence | GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKT QRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCG KLTKPKPQAESKKKKKEGKKQEKMLD | | Storage and Stability | Lyophilized powder may be stored at -20°C. Stable for 6 months at -20°C. Reconstitute with sterile ddH2O and 0.1% carrier protein. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 3 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Molecular Weight | 15.4kD | | Source | E. coli | | Purity | 98% by SDS-PAGE and HPLC. Endotoxin: 0.1ng/ug (1EU/ug). | | Form | Supplied as a lyophilized powder from PBS, pH 7.2. | | Reconstitute with ddH2O to 0.1-1.0mg/ml with 0.1% BSA or HSA as carrier protein | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|