You are here:Home
»
Antibodies
»
Abs to Resistin
»
Anti -Resistin, aa33-90 (RETN, Adipose tissue-specific secretory factor, ADSF, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3, FIZZ3, HXCP1, MGC12660
Anti -Resistin, aa33-90 (RETN, Adipose tissue-specific secretory factor, ADSF, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3, FIZZ3, HXCP1, MGC12660
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Rabbit |
Serum |
E |
|
| Catalog # | R1585-23D | | Applications | Suitable for use in ELISA. Other applications not tested. | | Recommended Dilution | Optimal dilutions to be determined by the researcher. | | Storage and Stability | Lyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | CAS Number | n/a | | Clone Type | Polyclonal | | Host | Rabbit | | Source | Human | | Concentration | ~1mg/ml | | Form | Supplied as a lyophilized powder in 50mM Tris, pH 7.2. Reconstitute in ddH2O. | | Purity | Serum | | Immunogen | Synthetic human Resistin (aa 33-90) bTG-conjugated | | (CQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMD | | WTGARCCRVQP) | | Specificity | Recognizes human Resistin (aa 33-90) | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|