Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Resistin » Anti -Resistin, aa33-90 (RETN, Adipose tissue-specific secretory factor, ADSF, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3, FIZZ3, HXCP1, MGC12660

Anti -Resistin, aa33-90 (RETN, Adipose tissue-specific secretory factor, ADSF,
C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich
secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3, FIZZ3, HXCP1,
MGC12660

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Rabbit Serum E
Catalog #R1585-23D
ApplicationsSuitable for use in ELISA. Other applications not tested.
Recommended DilutionOptimal dilutions to be determined by the researcher.
Storage and StabilityLyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
CAS Numbern/a
Clone TypePolyclonal
HostRabbit
SourceHuman
Concentration~1mg/ml
FormSupplied as a lyophilized powder in 50mM Tris, pH 7.2. Reconstitute in ddH2O.
PuritySerum
ImmunogenSynthetic human Resistin (aa 33-90) bTG-conjugated
(CQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMD
WTGARCCRVQP)
SpecificityRecognizes human Resistin (aa 33-90)
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links