Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Enzymes, Reductase » Anti -Ribonucleotide Reductase (Ribonucleoside-Diphosphate Reductase Large Subunit, Ribonucleoside-Diphosphate Reductase Subunit M1, Ribonucleotide Reductase Large Subunit, RRM1, RR1)

Anti -Ribonucleotide Reductase (Ribonucleoside-Diphosphate Reductase Large Subunit,
Ribonucleoside-Diphosphate Reductase Subunit M1, Ribonucleotide Reductase Large Subunit,
RRM1, RR1)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Rabbit Affinity Purified E B
RRM1 is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. Its gene is located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. Its gene may play a role in malignancies and disease that involve this region.
Catalog #R2031-15B
ApplicationsSuitable for use in ELISA and Western Blot. Other applications have not been tested.
Recommended DilutionsOptimal dilutions to be determined by researcher.
Storage and StabilityLyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O or PBS. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
IsotypeIgG
HostAbbit
SourceHuman
Concentration~1mg/ml after reconstitution
FormSupplied as a lyophilized powder from PBS, pH 7.4. . To reconstitute, add 100ul ddH2O.
PurityPurified by Protein A affinity chromatography
ImmunogenSynthertic peptide from the N-terminal region of RRM1 (ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL)
SpecificityRRecognizes human RRM1. Species crossreactivity: mouse, rat, dog, C. elegans and zebrafish.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links