Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Transcription Factors, STAT » Anti -STAT 1a (Signal Transducer and Activator of Transcription 1a)

Anti -STAT 1a (Signal Transducer and Activator of Transcription 1a)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Rabbit Highly Purified B IP
STATs (signal transducers and activators of transcription) are a family of cytoplasmic latent transcription factors that are activated in response to a large number of extracellular signals including cytokines, interferons, and growth factors. All seven STATs (STAT1, STAT2, STAT3, STAT4, STAT5a, STAT5b, and STAT6), STAT1, STAT3, STAT5a, and STAT5b have a wide activation profile (3,4). STAT1 is activated by many different ligands including the IFN family (IFN-alpha, IFN-beta, IFN-gama and IL-10), the gp130 family (IL-6, IL-11, LIF, CNTF, and G-CSF), and receptor tyrosine kinases (EGF, PDGF, CSF01) (3). STAT1 has two forms, the 91kD STAT1alpha and the 84kD STAT1beta, which are encoded by the same gene with splicing vari-ant (1). After tyrosine phosphorylation by Janus tyrosine kinase (JAK), STATs enter the nucleus to regulate transcription of many different genes.
Catalog #S7969-02
ApplicationsWestern Blot (ECL): 0.5ug/mL
Immunoprecipitation: 2-4ug/sample
Optimal dilutions to be determined by researcher.
Positive ControlsHeLa Cell Lysate
Rat Brain Tissue Extract F
Clone TypePolyclonal
HostRabbit
SourceHuman
FormSupplied as a liquid in PBS, pH 7.2, containing 0.02% sodium azide. Supplied as an IgG fraction.
PurityChromatographically purified
ImmunogenA 39 residue synthetic peptide VHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV based on the
human STAT1alpha (residues 712-750) was synthesized and the peptide cou-pled to KLH. The sequence differs from that of mouse by four amino acids. The carboxy terminal 38 amino acids are required to trigger transcription
SpecificityDetects a ~97kD protein, correspond-ing to the apparent molecular mass of STAT1alpha on SDS-PAGE immunoblots, in human, mouse, rat and bovine cell lysates and tissue extracts. This antibody does not detect the 84kD STAT1beta.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links