Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Transcription Factors, STAT » Anti -STAT3 (Signal Transducer and Activator of Transcription 3, Acute-phase Response Factor, APRF, FLJ20882, MGC16063)

Anti -STAT3 (Signal Transducer and Activator of Transcription 3, Acute-phase Response
Factor, APRF, FLJ20882, MGC16063)

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Clone Host Grade Applications
Polyclonal Rabbit Affinity Purified B IP IC
Cytokines and growth factors bind to specific cellular receptors that induce differential phosphorylation and activation of proteins called STATs (for Signal Transducers and Activators of Transcription). STAT3 is phosphorylated on a tyrosine residue after treatment of cells with Epidermal Growth Factor and Interleukin-6. It is not phosphorylated after treatment of cells with Interferon gamma. Phosphorylated STAT3 can either form homodimers with itself or heterodimers with STAT1 alpha. These complexes can bind to specific sequences in nuclear DNA and likely modulate gene transcription.
Catalog #S7971
ApplicationsSuitable for use in Immunoblot, Immunocytochemistry, Immunoprecipitation and Gel Shift Assay. Other applications not tested.
Recommended DilutionsImmunoblot: 0.5-2ug/ml detects STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6. EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2ug/ml). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system.
Immunocytochemistry: 10ug/ml shows positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid.
Immunoprecipitation: 4ug immunoprecipitates STAT 3 from 500ug of EGF-stimulated A431 RIPA lysate.
Gel Shift Assay: This antibody supershifts.
Optimal dilutions to be determined by researcher.
Positive Antigen Control (Included)A0001-55: EGF-stimulated A431 cell lysate.
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clone TypePolyclonal
FormSupplied as a liquid in 0.1M Tris-glycine, pH 7.4, 0.15M sodium chloride, 0.05% sodium azide, before the addition of glycerol to 40%.
PurityPurified by Protein A affinity chromatography.
ImmunogenBacterially expressed GST fusion protein corresponding to human STAT3 (aa688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.
SpecificityRecognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species Crossreactivity: Human, rat and mouse.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links