You are here:Home
»
Growth Factors, Cytokines
»
Growth Factors-TACI
»
TACI, Recombinant, Human (Transmembrane activator and CAML interactor)
TACI, Recombinant, Human (Transmembrane activator and CAML interactor)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Human TACI (Transmembrane activator and CAML interactor) is a newly discovered member of the TNF receptor superfamily. TACI is a receptor for BAFF (BlyS) and APRIL. Recombinant human TACI is a soluble 17.0kD protein containing 153 amino acid residues. | | | Catalog # | T0294 | | Biological Activity | Determined by its’ ability to block human BAFF induced T2B cell survival using a concentration range of 1-3ug/ml. | | AA Sequence | MSGLGRSRRG GRSRVDQEER FPQGLWTGVAMRSCPEEQYWDPLLGTCMSC KTICNHQSQR TCAAFCRSLS CRKEQGKFYDHLLRDCISCA SICGQHPKQC AYFCENKLRS PVNLPPELRRQRSGEVENNS DNSGRYQGLEHRGSEASPALPGLKLSADQV | | Storage and Stability | | | Lyophilized powder may be stored at -20°C. Reconstitute to nominal volume by adding ddH20 and a carrier protein. Aliquot and store at -20°C. Reconstituted product is stable for 3 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | Country of Origin | USA | | Molecular Weight | 17.8kD | | Source | E. coli | | Purity | 98% by SDS-PAGE and HPLC analyses. Endotoxin: 0.1ng/ug (1EU/ug) | | Form | Supplied as a lyophilized powder from 10mM sodium citrate, pH 4.0, 150mM sodium chloride. Reconstitution: Reconstitute with ddH20 and a carrier protein to a concentration of 0.1-1mg/ml. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
