Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Growth Factors, Cytokines » Growth Factors-TACI » TACI, Recombinant, Human (Transmembrane activator and CAML interactor)

TACI, Recombinant, Human (Transmembrane activator and CAML interactor)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Human TACI (Transmembrane activator and CAML interactor) is a newly discovered member of the TNF receptor superfamily. TACI is a receptor for BAFF (BlyS) and APRIL. Recombinant human TACI is a soluble 17.0kD protein containing 153 amino acid residues.
Catalog #T0294
Biological ActivityDetermined by itsí ability to block human BAFF induced T2B cell survival using a concentration range of 1-3ug/ml.
AA SequenceMSGLGRSRRG GRSRVDQEER FPQGLWTGVAMRSCPEEQYWDPLLGTCMSC KTICNHQSQR TCAAFCRSLS CRKEQGKFYDHLLRDCISCA SICGQHPKQC AYFCENKLRS PVNLPPELRRQRSGEVENNS DNSGRYQGLEHRGSEASPALPGLKLSADQV
Storage and Stability
Lyophilized powder may be stored at -20°C. Reconstitute to nominal volume by adding ddH20 and a carrier protein. Aliquot and store at -20°C. Reconstituted product is stable for 3 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Country of Origin USA
Molecular Weight17.8kD
SourceE. coli
Purity98% by SDS-PAGE and HPLC analyses. Endotoxin: 0.1ng/ug (1EU/ug)
FormSupplied as a lyophilized powder from 10mM sodium citrate, pH 4.0, 150mM sodium chloride. Reconstitution: Reconstitute with ddH20 and a carrier protein to a concentration of 0.1-1mg/ml.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links