
Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Toll Like Receptors (TLR) » Anti -TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3)

Anti -TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052,
MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3)


  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.


Clone Host Grade Applications
Polyclonal Goat Affinity Purified E IH
Catalog #T8050-45A
Suitable for use in ELISA and Immunohistochemistry. Other applications have not been tested.
Recommended DilutionELISA: 1:75,000
Immunohistochemistry: 1:250. Human spleen
Optimal dilutions to be determined by the researcher.
Storage and StabilityMay be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot and add glycerol (40-50%). Freeze at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
ConcentrationAs reported
FormSupplied as a liquid in PBS, pH 7.2, 1mg/ml BSA, 0.1% sodium azide.
PurityPurified by immunoaffinity chromatography.
ImmunogenSynthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5.
SpecificityRecognizes human TLR5. Peptide sequence is < 50% identical to other human TLR receptors in this region. Not tested for crossreactivity to mouse TLR5.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links