You are here:Home
»
Antibodies
»
Abs to Toll Like Receptors (TLR)
»
Anti -TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3)
Anti -TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052,
MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3)
Pricing
For pricing information, USA customers sign in. Outside USA? Please contact your distributor for pricing. Specifications
| Clone |
Host |
Grade |
Applications |
| Polyclonal |
Goat |
Affinity Purified |
E IH |
|
| Catalog # | T8050-45A | | Applications | | | Suitable for use in ELISA and Immunohistochemistry. Other applications have not been tested. | | Recommended Dilution | ELISA: 1:75,000 | | Immunohistochemistry: 1:250. Human spleen | | Optimal dilutions to be determined by the researcher. | | Storage and Stability | May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, aliquot and add glycerol (40-50%). Freeze at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | | CAS Number | n/a | | Clone Type | Polyclonal | | Isotype | IgG | | Host | Goat | | Source | Human | | Concentration | As reported | | Form | Supplied as a liquid in PBS, pH 7.2, 1mg/ml BSA, 0.1% sodium azide. | | Purity | Purified by immunoaffinity chromatography. | | Immunogen | Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5. | | Specificity | Recognizes human TLR5. Peptide sequence is < 50% identical to other human TLR receptors in this region. Not tested for crossreactivity to mouse TLR5. | | | Important Note | This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. |
External Links
|
