
Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Antibodies-Toll Like Receptors (TLR) » Anti -TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3)

Anti -TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052,
MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3)


  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.


Clone Host Grade Applications
Polyclonal Goat Affinity Purified B IH IC FC
Catalog #T8050-45C
ApplicationsSuitable for use in Flow Cytometry, Immunocytochemistry, Immunohistochemistry and Western Blot. Other applications not tested.
Recommended DilutionsImmunocytochemistry: 1:500. Used on peripheral blood leukocytes.
Immunohistochemistry (paraffin sections): 1:250.
Optimal dilutions to be determined by the researcher.
Storage and Stability
May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Clone TypePolyclonal
FormSupplied as a liquid in PBS containing 1mg/ml BSA and 0.1% sodium azide.
PurityPurified by epitope affinity chromatography.
ImmunogenSynthetic peptide corresponding to aa 151-181 (D151LSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ181) of human TLR5 (Toll-like receptor 5).
SpecificityRecognizes human TLR5.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

External Links