Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Antibodies » Abs to Toll Like Receptors (TLR) » Anti -TLR5 (Toll-like Receptor 5, Toll/Interleukin-1 Receptor-like Protein 3, TIL3)

Anti -TLR5 (Toll-like Receptor 5, Toll/Interleukin-1 Receptor-like Protein 3, TIL3)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

Clone Host Grade Applications
Polyclonal Rabbit Serum E
The Toll-like receptor (TLR) family in mammal comprises a family of transmembrane proteins characterized by multiple copies of leucine rich repeats in the extracellular domain and IL-1 receptor motif in the cytoplasmic domain. Like its counterparts in Drosophila, TLRs signal through adaptor molecules and could constitute an important and unrecognized component of innate immunity in humans. The TLR family is a phylogenetically conserved mediator of innate immunity that is essential for microbial recognition. TLRs characterized so far activate the MyD88/interleukin-1 receptor-associated kinase (IRAK) signaling pathway. Thirteen homologs of TLRs (TLR1-13) have been described. Toll-like receptor 5 (TLR5) expression is upregulated following exposure to bacteria or to the TLR5 agonist, flagellin. Gram-negative bacteria, stimulate monocyte/macrophage cells in a TLR5-specific, CD14-independent manner. The TLR5 receptor thus appears to be the principal means by which the innate immune system recognizes flagellated bacterial pathogens.
Catalog #T8050-45H
ApplicationsSuitable for use in ELISA. Other applications not tested.
Recommended DilutionELISA: 1:5000
Optimal dilutions to be determined by the researcher.
Storage and StabilityMay be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clone TypePolyclonal
IsotypeIgG
HostRabbit
SourceHuman
ConcentrationNot determined.
FormSupplied as a liquid, 0.05% sodium azide, glycerol.
PuritySerum
ImmunogenSynthetic peptide corresponding to aa151-181 (CDLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ) of human TLR5 (Genbank accession no. NP_003259).
SpecificityRecognizes human TLR5.
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links