Login

Forgot your password?
New User?
Remember me
banner banner

You are here:Home » Growth Factors, Cytokines » Growth Factors-TGF » Transforming Growth Factor beta Induced, Recombinant, Human (BIGH3, TGFBI, ig-h3)

Transforming Growth Factor beta Induced, Recombinant, Human (BIGH3, TGFBI, ig-h3)

Pricing

  For pricing information, USA customers sign in.
  Outside USA? Please contact your distributor for pricing.

Specifications

BIGH3, also known as TGFBI and ig-h3, is an extracellular matrix protein induced by transforming growth factor(TGF)-beta 1. BIGH3 protein is involved in cell growth, cell differentiation, wound healing and cell adhesion. In addition, some missense mutations of BIGH3 were identified in families affected with human autosomal dominant corneal dystrophies. BIGH3 gene encodes for a 683 amino-acid protein containing an RGD motif and four internal repeated domains which have highly conserved sequences founded in several species (Fasciclin domain). Recombinant human BIGH3 protein (fourth FAS domain) was expressed in E. coli and purified by using conventional chromatography techniques.
Catalog #T8252-90
Molecular Weight14.5kD (135 amino acids, residues 502-636)
SequenceMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVF
APTNEAFRALPPRERSRLLGDAKELANILKYHIGDEILV
SGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDI
MATNGVVHVITNVLQPPA
Storage and StabilityMay be stored at 4°C for short-term only. For long-term storage, store at -20°C. Aliquots are stable for at least 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight14.5 kD
SourceHuman, Recombinant E. coli
Purity95% by SDS PAGE
Concentration~1mg/ml
FormSupplied as a liquid in 20mM Tris-HCl, pH 8.0
Important NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.


External Links