USBio Logo

372194 AIFM1, Recombinant, Human, aa103-612, His-SUMO-Tag (Apoptosis-inducing Factor 1, Mitochondrial) CAS:

Specifications
References
Grade
Purified
Swiss Prot
O95831
Molecular Weight
71.5
EU Commodity Code
30021019
Shipping Temp
Blue Ice
Storage Temp
-20°C
Programmed Cell Death Protein 8

Functions both as NADH oxidoreductase and as regulator of apoptosis. In response to apoptotic stimuli, it is released from the mitochondrion intermbrane space into the cytosol and to the nucleus, where it functions as a proapoptotic factor in a caspase-independent pathway. In contrast, functions as an antiapoptotic factor in normal mitochondria via its NADH oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e. caspase-independent fragmentation of chromosomal DNA. Interacts with EIF3G, and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. Plays a critical role in caspase-independent, pyknotic cell death in hydrogen peroxide-exposed cells. Binds to DNA in a sequence-independent manner.

Partial recombinant protein corresponding to aa103-612 from human AIFM1, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: O95831
Molecular Weight
~71.5kD
Amino Acid Sequence
GLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Source
Recombinant, E. coli
Purity
≥90% (SDS-PAGE)
Concentration
As Reported
Form
Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
References
1. Molecular characterization of mitochondrial apoptosis-inducing factor.Susin S.A., Lorenzo H.K., Zamzami N., Marzo I., Snow B.E., Brothers G.M., Mangion J., Jacotot E., Costantini P., Loeffler M., Larochette N., Goodlett D.R., Aebersold R., Siderovski D.P., Penninger J.M., Kroemer G.Nature 397:441-446(1999).
USBio References
No references available
Pricing
Order
Proceed to Checkout
Cart Summary
ProductSizeListYour PriceQtyExt Price
Subtotal:Subtotal:
Subtotal:Subtotal:
Total Coupon Savings:Total Coupon Savings:()
Your cart is currently empty.
- Coupon Code
Recently Viewed
  • Contact Us

    Visit our technical library or contact our support staff to answer your questions.

    Telephone:
    1-800-520-3011

    Library | Contact

    Distributors

    For customers outside of the United States, please use one of our many distributors.

    View Distributors

    Payment Methods

    We accept the following payment methods as well as pay-by-invoice.

    MasterCard Visa PayPal
    © 2023-2024 United States Biological - All Rights Reserved