Technical Data
122789
AATK (Serine/Threonine-protein Kinase LMTK1, Lemur Tyrosine Kinase 1, Apoptosis-associated Tyrosine Kinase, AATYK, Brain Apoptosis-associated Tyrosine Kinase, CDK5-binding Protein, p35-binding Protein, p35BP, AATYK, KIAA0641, LMR1, LMTK1)
Description:
Apoptosis-associated tyrosine-protein kinase (ATTK) interacts with CDK5 and may be involved in neuronal differentiation.

Applications:
Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG1,k5B8Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa161-260 from human AATK (AAH47378) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human AATK.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.