Technical Data
122829
ABL2 (Tyrosine-protein Kinase ABL2, Abelson Murine Leukemia Viral Oncogene Homolog 2, Abelson-related Gene Protein, Tyrosine Kinase ARG, ABLL, ARG)
Description:
ABL2 is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. ABL2 is expressed in both normal and tumor cells.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2a,k6D5Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa743-842 from human ABL2 (AAH65912) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human ABL2.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.