Technical Data
122966
ADAM 17 (Disintegrin and Metalloproteinase Domain-containing Protein 17, Snake Venom-like Protease, TNF-alpha Convertase, TNF-alpha-converting Enzyme, CD156b, CSVP, TACE, ADAM17, MGC71942)
Description:
Membrane-bound form of TNF-a is cleaved by a convertase to generate a secreted 17kD mature protein. TNF-a converting enzyme, TACE, is a membrane bound metalloprotease-disintegrin. It also processes other cell surface proteins, including TNF receptor, TGFa, and alpha cleavage of amyloid protein precursor.

Applications:
Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDV

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2b,k1F6Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa215-315 from human ADAM17 (NP_003174) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human ADAM17.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.