Technical Data
123285
AIFM2 (Apoptosis-inducing Factor 2, Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer of Death, Apoptosis-inducing Factor-like Mitochondrion-associated Inducer of Death, p53-responsive Gene 3 Protein, AMID, PRG3, DKFZp686L1298, FLJ1449
Description:
The p53 tumor suppressor protein induces cell cycle arrest or apoptosis in response to cellular stresses. PRG3 (p53-responsive gene 3), is induced specifically under p53-dependent apoptotic conditions in human colon cancer cells. PRG3 has significant homology to bacterial oxidoreductases and the apoptosis-inducing factor, AIF. Unlike AIF, PRG3 localizes in the cytoplasm and its ectopic expression induces apoptosis. The PRG3 gene is thus a novel p53 target gene in a p53-dependent apoptosis pathway.

Applications:
Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVG

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG1,k2C6Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa1-339 from human AMID (AAH06121) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human AMID.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.