Technical Data
123380
AP2S1 (Adaptor-related Protein Complex 2 sigma 1 Subunit, AP2 Complex Subunit sigma 1, AP-2 Complex Subunit sigma 1, AP 17, AP17, AP17 delta, Clathrin Assembly Protein 2 Small Chain, Clathrin-associated/assembly/adaptor Protein Small 2, CLAPS2, Clathrin C
Description:
Adapter-related protein complex 2 sigma-1 subunit (AP2S1, AP17) is the component of the adaptor complexes which links clathrin to receptors in coated vesicles.It is the smallest polypeptide chain component of AP-2, a heterotetramer composed of two large adaptins (alpha-type subunit, AP2 alpha, and beta-type subunit, AP2 beta), a medium adaptin (mu-type subunit, AP2 mu1) and a small adaptin (sigma-type subunit, AP2S1).AP-2 is one of two major clathrin-associated protein complexes that interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2a,k3E4Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Full length recombinant corresponding to aa1-142 from human AP2S1 (AAH06337) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human AP2S1.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.