Technical Data
123404
APLP2 (Amyloid-like Protein 2, APLP-2, Amyloid Protein Homolog, APPH, APPL2, CDEBP, CDEI Box-binding Protein)
Description:
Amyloid beta precursor-like protein 2 (APLP-2) is a 120-170kD member of the APP family of neuronal type I transmembrane proteins. Its extracellular domain consists of an N-terminal Cys-rich domain, an Asp/Glu-rich acidic region, a Kunitz protease inhibitor (KPI) domain, and a GAG attachment site in the membrane proximal domain. APLP-2 forms both homodimers and heterodimers with APP and APLP-1. Proteolytic cleavage of APLP-2 generates peptides similar to the amyloidogenic Ab peptides and a cytoplasmic fragment that functions as a transcriptional coactivator. Alternate splicing of APLP-2 generates isoforms that lack the KPI domain or contain an insertion that prevents GAG attachment. The extracellular domain of human APLP-2 shares 81%, 93% aa sequence identity with mouse and rat APLP-2, respectively.

Applications:
Suitable for use in ELISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
AGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQ

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2b,k4B5Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa41-150 from human APLP2 (AAH00373) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human APLP2.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.