Technical Data
123702
ATP2C1 (KIAA1347, PMR1L, Calcium-transporting ATPase Type 2C Member 1, ATP-dependent Ca(2+) Pump PMR1)
Description:
The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.

Applications:
Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunofluorescence. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG1 lambda2G1Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa119-269 from human ATP2C1 (AAH28139) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human ATP2C1.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.