Technical Data
123780
B3GNT6 (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase, I-beta-1,3-N-acetylglucosaminyltransferase, iGnT, Poly-N-acetyllactosamine Extension Enzyme, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1, B3GNT1, MGC119334, MGC11933
Description:
This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen.

Applications:
Suitable for use in ELISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
MabIgG2b,k2H6Affinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Partial recombinant corresponding to aa316-416 from human B3GNT6 (NP_006867) with GST tag. MW of the GST tag alone is 26kD.
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human B3GNT6.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.