Technical Data
123862
BCAP31 (B-cell Receptor-associated Protein 31, BCR-associated Protein 31, Bap31, 6C6-AG Tumor-associated Antigen, Protein CDM, p28, BAP31, DXS1357E)
Description:
BAP31 appears to be a multi-functional ER-associated transport protein which was originally identified through its association with membrane IgD in B lymphocytes. Several proteins have since been shown to associate with BAP31, including the Beta2 integrin receptor CD11b/CD18, and nonmuscle gamma-actin and myosin B heavy chain. BAP31 has become a focus area for apoptosis studies due to its association with Bcl-2 and cleavage by initiator caspases including caspase 1 and 8. Cleavage of BAP31 generates a membrane-integrated p20 fragment which is itself a potent inducer of apoptosis when expressed ectopically.

Applications:
Suitable for use in Immunofluorescence and Western Blot. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
PabIgGAffinity Purified
SizeStorageShippingSourceHost
50ug-20CBlue IceHumanMouse
Concentration:
As reported
Immunogen:
Full-length human BCAP31, aa1-246 (NP_005736.3).
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human BCAP31.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.