Technical Data
124493
CCRK (Cell Division Protein Kinase 20, Cell Cycle-related Kinase, Cyclin-kinase-activating Kinase p42, CDK-activating Kinase p42, CAK-kinase p42, Cyclin-dependent Protein Kinase H, CDK20, CDCH)
Description:
CCRK contains a kinase domain most closely related to the cyclin-dependent protein kinases. This protein is involved in cell growth and activates CDK2, a kinase involved in the control of the cell cycle, by phosphorylating residue Thr-160.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV

Storage and Stability:
May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
TypeIsotypeCloneGrade
PabIgGAffinity Purified
SizeStorageShippingSourceHost
100ug-20CBlue IceHumanRabbit
Concentration:
As reported
Immunogen:
Full length human CCRK, aa1-275 (AAH02655.1).
Purity:
Purified by Protein A affinity chromatography.
Form
Supplied as a liquid in PBS, pH 7.2.
Specificity:
Recognizes human CCRK. Species Crossreactivity: mouse.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.